PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla001326
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family GeBP
Protein Properties Length: 423aa    MW: 46228.6 Da    PI: 5.7421
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla001326genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573133.67e-42189285197
     DUF573   1 klfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                klfqrlwse+Dei++L G+id+ ak+g++p  d++af++f+kks++++v+k qlv+KirrLKkK++++ ++ k+g +p+fsk+h+qk felskkiWg
  Cla001326 189 KLFQRLWSEDDEIAILNGMIDYSAKKGADPALDMNAFHDFIKKSLHVDVTKAQLVDKIRRLKKKYRNNADRGKKGADPTFSKPHEQKGFELSKKIWG 285
                579*********************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.3E-37191285IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0005829Cellular Componentcytosol
GO:0009507Cellular Componentchloroplast
GO:0016592Cellular Componentmediator complex
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MAPKRPSPLD EPPAASSSEE EETSSGEEEE GVSRDGSSSE EEEDEEETQA QTQIQKLKKP  60
SALPSTPIVE KKTVPKKSEL PSNSQAQSSS SESGSGSDTD SDTESGRNVK PIASKPMEET  120
PKAKKPRSKP SASASASASA SATPARPSLK RPSETTRDAK RPKKSSEADA DDGVVAEDDP  180
KKSVDESKKL FQRLWSEDDE IAILNGMIDY SAKKGADPAL DMNAFHDFIK KSLHVDVTKA  240
QLVDKIRRLK KKYRNNADRG KKGADPTFSK PHEQKGFELS KKIWGGEGIF RTPVVEQPKP  300
NANGTPKKNQ RGNTSKTLAS LKAELLPSPD APKEDDKMKI DDSEAPSGCM DGFVAFERSL  360
GAVGLPESFL KPGLELIGQS KRTELEEEWK KLYLAELELF LKRTELIRDQ TKLILDAYKS  420
SSK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818750.0LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008439944.10.0PREDICTED: mediator-associated protein 1
TrEMBLA0A0A0KN490.0A0A0A0KN49_CUCSA; Transcription regulator
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.14e-38DNA-binding storekeeper protein-related transcriptional regulator